FreeAPIHub
HomeAPIsAI ModelsAI ToolsBlog
Favorites
FreeAPIHub

The central hub for discovering, testing, and integrating the world's best AI models and APIs.

Platform

  • Categories
  • AI Models
  • APIs

Company

  • About Us
  • Contact
  • FAQ

Help

  • Terms of Service
  • Privacy Policy
  • Cookies

© 2026 FreeAPIHub. All rights reserved.

GitHubTwitterLinkedIn
  1. Home
  2. AI Models
  3. Bioinformatics
  4. AlphaFold
freeother

AlphaFold

Nobel Prize-winning AI that predicts 3D protein structures — free

Developed by Google DeepMind

Try Model
~93M (AF2)Params
YesAPI
stableStability
AlphaFold 3Version
Apache 2.0 (AF2) / Custom (AF3)License
JAXFramework
YesRuns Local

Playground

Implementation Example

Example Prompt

user input
Predict the structure of human hemoglobin alpha chain (sequence: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVK...)

Model Output

model response
Returns a PDB file with 3D atomic coordinates and per-residue pLDDT confidence scores (typically 90+ for well-known proteins like hemoglobin), viewable in PyMOL or ChimeraX.

Examples

Real-World Applications

  • Drug discovery
  • antibody design
  • enzyme engineering
  • vaccine research
  • disease mechanism studies
  • CRISPR research
  • synthetic biology
  • protein-ligand interaction prediction.

Docs

Model Intelligence & Architecture

What is AlphaFold?

AlphaFold is the breakthrough AI system from Google DeepMind that solved the 50-year-old protein-folding problem. Originally released in 2018 (AlphaFold 1) and dramatically improved in 2020 (AlphaFold 2) and 2024 (AlphaFold 3), it predicts the 3D structure of proteins from amino-acid sequences with near-experimental accuracy.

The work earned Demis Hassabis and John Jumper the 2024 Nobel Prize in Chemistry, alongside David Baker. AlphaFold 2's source code is open-source under Apache 2.0, while AlphaFold 3 is available through the AlphaFold Server for academic use.

Why AlphaFold Is Trending in 2026

AlphaFold has fundamentally transformed biology, drug discovery, and structural biology. With over 200 million protein structures predicted in the AlphaFold Protein Structure Database, scientists no longer need months of expensive lab work to determine basic protein shapes.

AlphaFold 3 (May 2024) extended capability to predict protein-DNA, protein-RNA, protein-ligand, and protein-antibody interactions, making it indispensable for modern drug development.

Key Features and Capabilities

AlphaFold 2 takes an amino-acid sequence as input and outputs 3D atomic coordinates with per-residue confidence scores (pLDDT). AlphaFold 3 expands this to predict structures of complexes including small molecules, ions, and post-translational modifications.

The AlphaFold Protein Structure Database (alphafold.ebi.ac.uk) contains pre-computed structures for nearly every known protein on Earth — free to download.

Who Should Use AlphaFold?

AlphaFold is essential for biologists, pharmaceutical researchers, structural biologists, biotech engineers, drug-discovery scientists, and academic researchers studying enzymes, antibodies, viral proteins, or any biological molecule.

It's also widely used in synthetic biology, protein engineering, and the design of novel therapeutics, enzymes, and biosensors.

Top Use Cases

Real-world applications include drug target identification, antibody design, enzyme engineering, vaccine development, understanding disease mechanisms (including cancer and rare diseases), CRISPR research, food-science enzyme optimization, and understanding antibiotic resistance.

Pharmaceutical companies use AlphaFold to dramatically accelerate the early stages of drug pipelines, sometimes shortening years of work to weeks.

Where Can You Use It?

For AlphaFold 2 self-hosting, the official GitHub repo provides Docker containers — though it requires significant disk space (~600 GB for databases) and a powerful GPU. Easier options include ColabFold (free Google Colab notebook), AlphaFold Server (alphafoldserver.com), and ESMFold (Meta's faster alternative).

The full database of pre-computed structures is hosted at the EBI and freely searchable.

How to Use AlphaFold (Quick Start)

The fastest path is ColabFold by Sergey Ovchinnikov — a free Google Colab notebook where you paste a protein sequence and receive a 3D structure in 5–15 minutes. For batch use, install ColabFold locally with pip install colabfold.

For protein complexes and small molecules, use the AlphaFold Server (free academic tier) at alphafoldserver.com.

When Should You Choose AlphaFold?

Choose AlphaFold whenever you need a reliable structural prediction for any protein. AlphaFold 2 is best for single proteins; AlphaFold 3 is the right pick for complexes with ligands, DNA, or RNA.

For very fast predictions at slightly lower accuracy, ESMFold (from Meta) is a good alternative — and works well for high-throughput screens.

Pricing

AlphaFold 2 is completely free under Apache 2.0. The pre-computed database is free for everyone. AlphaFold Server is free for non-commercial academic use, with up to 20 jobs per day.

Pros and Cons

Pros: ✔ Nobel Prize-winning accuracy ✔ Apache 2.0 (AF2) ✔ 200M+ predicted structures available ✔ AlphaFold 3 supports complexes ✔ Free academic access ✔ Massive scientific impact

Cons: ✘ AF3 not open-source ✘ Heavy compute for self-hosting ✘ Limited to 20 jobs/day on AlphaFold Server ✘ Doesn't predict dynamics

Final Verdict

AlphaFold is one of the most important AI achievements in history and a must-use tool for anyone in biology or drug discovery. Discover more scientific AI on FreeAPIHub.com.

Evaluation

Advantages & Limitations

Advantages
  • ✓ Nobel Prize-winning accuracy
  • ✓ 200M+ structures pre-computed
  • ✓ Apache 2.0 (AF2)
  • ✓ AlphaFold 3 handles complexes
  • ✓ Free academic use
  • ✓ Massive scientific community
Limitations
  • ✗ AlphaFold 3 not open-source
  • ✗ Heavy storage and compute
  • ✗ 20 jobs/day limit on server
  • ✗ No dynamics prediction

Important Notice

Verify Before You Decide

Last verified · Apr 29, 2026

The details on this page — including pricing, features, and availability — are based on our last review and may not reflect the provider's current offering. Providers update their products frequently, sometimes without prior notice.

What may have changed

Pricing Plans
Features & Limits
Availability
Terms & Policies

Always visit the official provider website to confirm the latest pricing, terms, and feature availability before subscribing or integrating.

Check official site

External Resources

Try the Model Official Website Source Code

Technical Details

Architecture
Evoformer + Structure Module (AF2); Diffusion (AF3)
Stability
stable
Framework
JAX
License
Apache 2.0 (AF2) / Custom (AF3)
Release Date
2018-12-02
Signup Required
Yes
API Available
Yes
Runs Locally
Yes

Rate Limits

20 jobs/day on AlphaFold Server; unlimited self-hosted

Pricing

Free for academic and personal use

Best For

Researchers and biotech teams predicting protein structures and interactions

Alternative To

X-ray crystallography (for initial structure), Rosetta

Compare With

alphafold vs esmfoldalphafold 2 vs 3alphafold vs rosettafoldbest protein folding ai

Tags

#Drug Discovery#Alphafold#Protein Folding#Bioinformatics#Google Deepmind#Open Source AI

You Might Also Like

More AI Models Similar to AlphaFold

ESMFold v2

ESMFold v2 by Meta AI is a free open-source protein structure prediction AI that's 60x faster than AlphaFold 2. MIT license, predicts structure from sequence alone — no MSA needed. Perfect for high-throughput biology research.

open sourceother

EvoDiff

EvoDiff by Microsoft is a free open-source diffusion model for protein sequence generation. Design novel proteins for drugs, enzymes, and biotech. MIT license, complementary to AlphaFold for structure prediction.

open sourceother

Gemma 3 27B

Gemma 3 27B by Google DeepMind is a free open-weights multimodal LLM with 128K context, 140+ language support, and vision input. Runs on a single GPU. Best free Gemini alternative for self-hosting in 2026.

open sourcemultimodal