FreeAPIHub
HomeAPIsAI ModelsAI ToolsBlog
Favorites
FreeAPIHub

The central hub for discovering, testing, and integrating the world's best AI models and APIs.

Platform

  • Categories
  • AI Models
  • APIs

Company

  • About Us
  • Contact
  • FAQ

Help

  • Terms of Service
  • Privacy Policy
  • Cookies

© 2026 FreeAPIHub. All rights reserved.

GitHubTwitterLinkedIn
  1. Home
  2. AI Models
  3. Bioinformatics
  4. ESMFold v2
open sourceother

ESMFold v2

Free protein structure AI 60x faster than AlphaFold — no MSA needed

Developed by Meta AI (FAIR)

Try Model
15B (ESM-2 largest)Params
YesAPI
stableStability
ESM-2 / ESM3Version
MITLicense
PyTorchFramework
YesRuns Local

Playground

Implementation Example

Example Prompt

user input
Predict the 3D structure of this novel enzyme sequence: MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLR... (300 residues)

Model Output

model response
Returns a PDB file in ~5 seconds (vs ~30 min for AlphaFold 2). Output contains 3D atomic coordinates with per-residue pLDDT confidence scores; alpha helices and beta sheets are identified. Suitable for downstream docking studies in PyMOL or AutoDock.

Examples

Real-World Applications

  • High-throughput protein structure prediction
  • drug-target identification
  • metagenomic analysis
  • antibody design
  • enzyme engineering
  • vaccine development.

Docs

Model Intelligence & Architecture

What is ESMFold v2?

ESMFold is a fast protein structure prediction model developed by Meta AI's FAIR team, released in July 2022 with continued improvements through ESM-2 and ESM3 (with ESMFold v2 referring to the production-ready ESM-2 based system). Unlike AlphaFold 2, ESMFold predicts 3D protein structures directly from a single amino acid sequence — no multiple sequence alignment (MSA) required.

This makes ESMFold up to 60× faster than AlphaFold 2, enabling high-throughput predictions across millions of proteins. It's released under the MIT license.

Why ESMFold Is Trending in 2026

As protein design and drug discovery accelerate, demand for fast structure prediction has exploded. ESMFold's speed enabled the ESM Atlas — a public database of 617 million predicted protein structures from metagenomics data, the largest such database ever created.

The newer ESM3 (2024) goes beyond prediction to support generative protein design, opening new possibilities for synthetic biology.

Key Features and Capabilities

ESMFold supports protein 3D structure prediction from sequence alone, batch prediction at scale, no-MSA inference (60x faster than AlphaFold), per-residue confidence scores, and integration with downstream protein engineering tools.

Who Should Use ESMFold?

ESMFold is built for structural biologists, drug-discovery teams, biotech startups, metagenomics researchers, and synthetic biology engineers needing fast, scalable structure prediction.

Top Use Cases

Real-world applications include high-throughput protein structure prediction, drug-target identification, metagenomic analysis, antibody design, enzyme engineering, vaccine development, and synthetic biology workflows.

Where Can You Run It?

ESMFold runs on Hugging Face Transformers, Meta's official ESM repository, and the ESM Atlas web interface. The full model needs ~24 GB VRAM, but smaller distilled variants run on consumer GPUs.

How to Use ESMFold (Quick Start)

Install: pip install fair-esm. Predict: import esm; model, alphabet = esm.pretrained.esmfold_v1(); structure = model.infer_pdb(your_sequence). Returns a PDB file in seconds.

When Should You Choose ESMFold?

Choose ESMFold when you need fast, scalable structure prediction, especially for novel proteins without homologs in databases. For maximum accuracy, use AlphaFold 3 instead.

Pricing

ESMFold is completely free under MIT license. The ESM Atlas web service is free for all users.

Pros and Cons

Pros: ✔ MIT license ✔ 60× faster than AlphaFold 2 ✔ No MSA required ✔ Excellent for orphan proteins ✔ Powers ESM Atlas (617M structures) ✔ Active Meta development

Cons: ✘ Slightly less accurate than AlphaFold 2/3 ✘ Doesn't model protein-ligand complexes ✘ Heavy VRAM for full model

Final Verdict

ESMFold is the speed champion of protein structure prediction in 2026 — essential for high-throughput biology and drug discovery. Discover more scientific AI at FreeAPIHub.com.

Evaluation

Advantages & Limitations

Advantages
  • ✓ MIT license
  • ✓ 60x faster than AlphaFold 2
  • ✓ No MSA required
  • ✓ Excellent for orphan proteins
  • ✓ Powers ESM Atlas (617M structures)
  • ✓ Active Meta development
Limitations
  • ✗ Slightly less accurate than AlphaFold 2/3
  • ✗ Doesn't model protein-ligand complexes
  • ✗ Heavy VRAM for full model

Important Notice

Verify Before You Decide

Last verified · Apr 29, 2026

The details on this page — including pricing, features, and availability — are based on our last review and may not reflect the provider's current offering. Providers update their products frequently, sometimes without prior notice.

What may have changed

Pricing Plans
Features & Limits
Availability
Terms & Policies

Always visit the official provider website to confirm the latest pricing, terms, and feature availability before subscribing or integrating.

Check official site

External Resources

Try the Model Official Website Source Code

Technical Details

Architecture
Protein language model + folding head
Stability
stable
Framework
PyTorch
License
MIT
Release Date
2022-07-21
Signup Required
No
API Available
Yes
Runs Locally
Yes

Rate Limits

No limits self-hosted; ESM Atlas web service is free

Pricing

Completely free under MIT license

Best For

Researchers needing fast, scalable protein structure prediction at metagenomic scale

Alternative To

AlphaFold 2, RoseTTAFold

Compare With

esmfold vs alphafoldesm-2 vs alphafold 2esmfold vs rosettafoldfast protein folding aifree protein structure prediction

Tags

#Esmfold#Drug Discovery#Protein Folding#Bioinformatics#Meta AI#Open Source AI

You Might Also Like

More AI Models Similar to ESMFold v2

AlphaFold

AlphaFold by Google DeepMind is the Nobel Prize-winning AI that predicts 3D protein structures with near-experimental accuracy. AlphaFold 3 now models DNA, RNA, and ligand interactions. Free for academic research.

freeother

EvoDiff

EvoDiff by Microsoft is a free open-source diffusion model for protein sequence generation. Design novel proteins for drugs, enzymes, and biotech. MIT license, complementary to AlphaFold for structure prediction.

open sourceother

Fairseq

Fairseq by Meta AI is a free open-source sequence modeling toolkit for translation, summarization, language modeling, and speech tasks. MIT license, powers production NLP at Facebook scale. Foundational ML research framework.

open sourcellm